PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC10G07810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 222aa    MW: 25037.5 Da    PI: 10.6754
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC10G07810.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA78.99.4e-25111167158
        CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                      dep+YVNaKQy++Il+RRq+R+ + +e+k+ ++ rk++l eSR+k+A+ R+Rg+gGrF
  OPUNC10G07810.1 111 DEPVYVNAKQYHAILRRRQRRKIIGSEDKV-ATIRKRILVESRQKQAKLRRRGKGGRF 167
                      79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.0E-20109170IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115224.083110170IPR001289Nuclear transcription factor Y subunit A
PfamPF020459.3E-18112167IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.2E-14113135IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.2E-14144167IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MRRRYSAGRW EERKRGRGKL IYIGDKEGGR TTEGVPSCKS HVDIMGVGES NHVNQSKLDG  60
LGEVSTDLSL ANQEANSVHP KPEHIQPLKH IPTKGMRHIL LLPLPTEHAD DEPVYVNAKQ  120
YHAILRRRQR RKIIGSEDKV ATIRKRILVE SRQKQAKLRR RGKGGRFIST EHPLEPYVDD  180
QLSKNGGKIS PCTSTTSENS SNVIRDGLRT SPLMTKALVR DE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A4e-15111180271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015697306.11e-79PREDICTED: nuclear transcription factor Y subunit alpha-like
TrEMBLA0A0E0M7E01e-163A0A0E0M7E0_ORYPU; Uncharacterized protein
STRINGOB10G17040.14e-79(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP174681010
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17590.46e-19nuclear factor Y, subunit A8